Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,452
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 9,428
  3. Avatar for Bad Monkey 3. Bad Monkey 64 pts. 9,417
  4. Avatar for Go Science 4. Go Science 50 pts. 9,401
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,382
  6. Avatar for Contenders 6. Contenders 30 pts. 9,371
  7. Avatar for HMT heritage 7. HMT heritage 23 pts. 9,342
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 17 pts. 9,310
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,292
  10. Avatar for Deleted group 10. Deleted group pts. 9,266
  1. Avatar for TJOK fan 181. TJOK fan Lv 1 1 pt. 6,564
  2. Avatar for CAFN 182. CAFN Lv 1 1 pt. 6,538
  3. Avatar for maria_pl 183. maria_pl Lv 1 1 pt. 6,537
  4. Avatar for SMackoff_Chem251-601 184. SMackoff_Chem251-601 Lv 1 1 pt. 6,523
  5. Avatar for Tac1 185. Tac1 Lv 1 1 pt. 6,518
  6. Avatar for M Ghiorso iii 186. M Ghiorso iii Lv 1 1 pt. 6,455
  7. Avatar for Mydogisa Toelicker 187. Mydogisa Toelicker Lv 1 1 pt. 6,436
  8. Avatar for Pro Lapser 188. Pro Lapser Lv 1 1 pt. 6,404
  9. Avatar for PrettyPony2001 189. PrettyPony2001 Lv 1 1 pt. 6,403
  10. Avatar for NameChangeNeeded01 190. NameChangeNeeded01 Lv 1 1 pt. 6,401

Comments