Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Chem251-601 Spring 2016 21. Chem251-601 Spring 2016 1 pt. 6,523
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 6,377
  3. Avatar for Deleted group 23. Deleted group pts. 5,622
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452
  1. Avatar for Jaco van As 201. Jaco van As Lv 1 1 pt. 5,818
  2. Avatar for penteplayer 202. penteplayer Lv 1 1 pt. 5,810
  3. Avatar for grobeln2 203. grobeln2 Lv 1 1 pt. 5,763
  4. Avatar for briemoney 204. briemoney Lv 1 1 pt. 5,622
  5. Avatar for epolsky99 205. epolsky99 Lv 1 1 pt. 5,599
  6. Avatar for rezaefar 206. rezaefar Lv 1 1 pt. 5,577
  7. Avatar for shrayro 207. shrayro Lv 1 1 pt. 5,547
  8. Avatar for nazekaosman 208. nazekaosman Lv 1 1 pt. 5,483
  9. Avatar for rossco0407 209. rossco0407 Lv 1 1 pt. 5,481
  10. Avatar for ElderCunningham 210. ElderCunningham Lv 1 1 pt. 5,457

Comments