Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,452
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 9,428
  3. Avatar for Bad Monkey 3. Bad Monkey 64 pts. 9,417
  4. Avatar for Go Science 4. Go Science 50 pts. 9,401
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,382
  6. Avatar for Contenders 6. Contenders 30 pts. 9,371
  7. Avatar for HMT heritage 7. HMT heritage 23 pts. 9,342
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 17 pts. 9,310
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,292
  10. Avatar for Deleted group 10. Deleted group pts. 9,266
  1. Avatar for Jaco van As 201. Jaco van As Lv 1 1 pt. 5,818
  2. Avatar for penteplayer 202. penteplayer Lv 1 1 pt. 5,810
  3. Avatar for grobeln2 203. grobeln2 Lv 1 1 pt. 5,763
  4. Avatar for briemoney 204. briemoney Lv 1 1 pt. 5,622
  5. Avatar for epolsky99 205. epolsky99 Lv 1 1 pt. 5,599
  6. Avatar for rezaefar 206. rezaefar Lv 1 1 pt. 5,577
  7. Avatar for shrayro 207. shrayro Lv 1 1 pt. 5,547
  8. Avatar for nazekaosman 208. nazekaosman Lv 1 1 pt. 5,483
  9. Avatar for rossco0407 209. rossco0407 Lv 1 1 pt. 5,481
  10. Avatar for ElderCunningham 210. ElderCunningham Lv 1 1 pt. 5,457

Comments