Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Chem251-601 Spring 2016 21. Chem251-601 Spring 2016 1 pt. 6,523
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 6,377
  3. Avatar for Deleted group 23. Deleted group pts. 5,622
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452
  1. Avatar for christioanchauvin 41. christioanchauvin Lv 1 38 pts. 9,243
  2. Avatar for spvincent 42. spvincent Lv 1 37 pts. 9,242
  3. Avatar for johnmitch 43. johnmitch Lv 1 36 pts. 9,242
  4. Avatar for uhuuhu 44. uhuuhu Lv 1 35 pts. 9,240
  5. Avatar for g_b 45. g_b Lv 1 34 pts. 9,239
  6. Avatar for Mike Cassidy 46. Mike Cassidy Lv 1 33 pts. 9,236
  7. Avatar for Timo van der Laan 47. Timo van der Laan Lv 1 33 pts. 9,233
  8. Avatar for Anfinsen_slept_here 48. Anfinsen_slept_here Lv 1 32 pts. 9,232
  9. Avatar for mammuthus 49. mammuthus Lv 1 31 pts. 9,223
  10. Avatar for crpainter 50. crpainter Lv 1 30 pts. 9,220

Comments