Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,452
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 9,428
  3. Avatar for Bad Monkey 3. Bad Monkey 64 pts. 9,417
  4. Avatar for Go Science 4. Go Science 50 pts. 9,401
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,382
  6. Avatar for Contenders 6. Contenders 30 pts. 9,371
  7. Avatar for HMT heritage 7. HMT heritage 23 pts. 9,342
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 17 pts. 9,310
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,292
  10. Avatar for Deleted group 10. Deleted group pts. 9,266
  1. Avatar for christioanchauvin 41. christioanchauvin Lv 1 38 pts. 9,243
  2. Avatar for spvincent 42. spvincent Lv 1 37 pts. 9,242
  3. Avatar for johnmitch 43. johnmitch Lv 1 36 pts. 9,242
  4. Avatar for uhuuhu 44. uhuuhu Lv 1 35 pts. 9,240
  5. Avatar for g_b 45. g_b Lv 1 34 pts. 9,239
  6. Avatar for Mike Cassidy 46. Mike Cassidy Lv 1 33 pts. 9,236
  7. Avatar for Timo van der Laan 47. Timo van der Laan Lv 1 33 pts. 9,233
  8. Avatar for Anfinsen_slept_here 48. Anfinsen_slept_here Lv 1 32 pts. 9,232
  9. Avatar for mammuthus 49. mammuthus Lv 1 31 pts. 9,223
  10. Avatar for crpainter 50. crpainter Lv 1 30 pts. 9,220

Comments