Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Chem251-601 Spring 2016 21. Chem251-601 Spring 2016 1 pt. 6,523
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 6,377
  3. Avatar for Deleted group 23. Deleted group pts. 5,622
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452
  1. Avatar for WarpSpeed 51. WarpSpeed Lv 1 29 pts. 9,215
  2. Avatar for georg137 52. georg137 Lv 1 28 pts. 9,209
  3. Avatar for dcrwheeler 53. dcrwheeler Lv 1 28 pts. 9,203
  4. Avatar for WBarme1234 54. WBarme1234 Lv 1 27 pts. 9,184
  5. Avatar for jermainiac 55. jermainiac Lv 1 26 pts. 9,159
  6. Avatar for Graham MF 56. Graham MF Lv 1 25 pts. 9,151
  7. Avatar for joremen 57. joremen Lv 1 25 pts. 9,149
  8. Avatar for fiendish_ghoul 58. fiendish_ghoul Lv 1 24 pts. 9,136
  9. Avatar for smholst 59. smholst Lv 1 23 pts. 9,125
  10. Avatar for Museka 60. Museka Lv 1 23 pts. 9,106

Comments