1206: Unsolved De-novo Freestyle 73
Closed since almost 10 years ago
Intermediate Overall PredictionSummary
- Created
- March 12, 2016
- Expires
- Max points
- 100
The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!
Sequence:
QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK
Top groups
-
100 pts. 9,452
-
-
-
-
-
-
-
-
-