Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Chem251-601 Spring 2016 21. Chem251-601 Spring 2016 1 pt. 6,523
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 6,377
  3. Avatar for Deleted group 23. Deleted group pts. 5,622
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452
  1. Avatar for JUMELLE54 81. JUMELLE54 Lv 1 12 pts. 8,916
  2. Avatar for gurch 82. gurch Lv 1 11 pts. 8,916
  3. Avatar for ManVsYard 83. ManVsYard Lv 1 11 pts. 8,907
  4. Avatar for ratqueen03 84. ratqueen03 Lv 1 11 pts. 8,906
  5. Avatar for caglar 85. caglar Lv 1 10 pts. 8,890
  6. Avatar for tallguy-13088 86. tallguy-13088 Lv 1 10 pts. 8,883
  7. Avatar for sheerbliss 87. sheerbliss Lv 1 10 pts. 8,882
  8. Avatar for guineapig 88. guineapig Lv 1 9 pts. 8,872
  9. Avatar for Crossed Sticks 89. Crossed Sticks Lv 1 9 pts. 8,853
  10. Avatar for pvc78 90. pvc78 Lv 1 9 pts. 8,850

Comments