Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,452
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 9,428
  3. Avatar for Bad Monkey 3. Bad Monkey 64 pts. 9,417
  4. Avatar for Go Science 4. Go Science 50 pts. 9,401
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,382
  6. Avatar for Contenders 6. Contenders 30 pts. 9,371
  7. Avatar for HMT heritage 7. HMT heritage 23 pts. 9,342
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 17 pts. 9,310
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,292
  10. Avatar for Deleted group 10. Deleted group pts. 9,266

  1. Avatar for JUMELLE54 81. JUMELLE54 Lv 1 12 pts. 8,916
  2. Avatar for gurch 82. gurch Lv 1 11 pts. 8,916
  3. Avatar for ManVsYard 83. ManVsYard Lv 1 11 pts. 8,907
  4. Avatar for ratqueen03 84. ratqueen03 Lv 1 11 pts. 8,906
  5. Avatar for caglar 85. caglar Lv 1 10 pts. 8,890
  6. Avatar for tallguy-13088 86. tallguy-13088 Lv 1 10 pts. 8,883
  7. Avatar for sheerbliss 87. sheerbliss Lv 1 10 pts. 8,882
  8. Avatar for guineapig 88. guineapig Lv 1 9 pts. 8,872
  9. Avatar for Crossed Sticks 89. Crossed Sticks Lv 1 9 pts. 8,853
  10. Avatar for pvc78 90. pvc78 Lv 1 9 pts. 8,850

Comments