Placeholder image of a protein
Icon representing a puzzle

1207: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 15, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups


  1. Avatar for Beta Folders 100 pts. 10,252
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 10,229
  3. Avatar for Go Science 3. Go Science 65 pts. 10,211
  4. Avatar for Contenders 4. Contenders 52 pts. 10,153
  5. Avatar for Void Crushers 5. Void Crushers 41 pts. 10,100
  6. Avatar for Gargleblasters 6. Gargleblasters 32 pts. 10,084
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 10,064
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 18 pts. 10,062
  9. Avatar for Russian team 9. Russian team 14 pts. 9,985
  10. Avatar for HMT heritage 10. HMT heritage 10 pts. 9,982

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,252
  2. Avatar for Galaxie 2. Galaxie Lv 1 98 pts. 10,226
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 96 pts. 10,211
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 94 pts. 10,153
  5. Avatar for smilingone 5. smilingone Lv 1 91 pts. 10,139
  6. Avatar for gloverd 6. gloverd Lv 1 89 pts. 10,116
  7. Avatar for gitwut 7. gitwut Lv 1 87 pts. 10,112
  8. Avatar for Timo van der Laan 8. Timo van der Laan Lv 1 85 pts. 10,100
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 83 pts. 10,098
  10. Avatar for gmn 10. gmn Lv 1 81 pts. 10,098

Comments


Timo van der Laan Lv 1

With all the crashing, I am not able to do this puzzle right.
Currently in top 10 but I am sure I would get at least 100 pts more if I could run all scripts without crashing

O Seki To Lv 1

the puzzle constantly crashing. The top was 15 minutes continuous running time. Initially I thought the problem was with my computer, but it seems others have the same difficulties.

It would be great suspending this puzzle till the crashing bug eliminated…

grogar7 Lv 1

This puzzle should be suspended or deprecated. Those (like my team mate Galaxie) who have not accepted the update to main, are able to run this puzzle unimpeded. Those who did accept the update are crashing regularly on 1207. Seems unfair!

actiasluna Lv 1

FYI - I'm running from a freshly installed (not updated to an existing) application running the updated Main and 1207 is stable for me. It's worth the time to do! Just be sure you save your active puzzles and share them with yourself, and save the options.txt and all.macro files (your recipes and settings) from the old version before ditching the old application and reinstalling.

(This is particularly important to do periodically on the Mac platform, in which Foldit gets "foldit bloat" - the application grows over time and things slow down.)