Placeholder image of a protein
Icon representing a puzzle

1207: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 15, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 9,972
  2. Avatar for It's over 9000! 12. It's over 9000! 5 pts. 9,858
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 9,680
  4. Avatar for Bad Monkey 14. Bad Monkey 3 pts. 9,678
  5. Avatar for SETI.Germany 15. SETI.Germany 2 pts. 9,587
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 9,570
  7. Avatar for xkcd 17. xkcd 1 pt. 9,513
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,286
  9. Avatar for Team South Africa 20. Team South Africa 1 pt. 9,231

  1. Avatar for YeshuaLives 51. YeshuaLives Lv 1 26 pts. 9,918
  2. Avatar for georg137 52. georg137 Lv 1 26 pts. 9,910
  3. Avatar for Museka 53. Museka Lv 1 25 pts. 9,908
  4. Avatar for Deleted player 54. Deleted player pts. 9,907
  5. Avatar for phi16 55. phi16 Lv 1 23 pts. 9,901
  6. Avatar for t012 56. t012 Lv 1 23 pts. 9,899
  7. Avatar for caglar 57. caglar Lv 1 22 pts. 9,897
  8. Avatar for hansvandenhof 58. hansvandenhof Lv 1 21 pts. 9,891
  9. Avatar for isaksson 59. isaksson Lv 1 21 pts. 9,884
  10. Avatar for reefyrob 60. reefyrob Lv 1 20 pts. 9,872

Comments


Timo van der Laan Lv 1

With all the crashing, I am not able to do this puzzle right.
Currently in top 10 but I am sure I would get at least 100 pts more if I could run all scripts without crashing

O Seki To Lv 1

the puzzle constantly crashing. The top was 15 minutes continuous running time. Initially I thought the problem was with my computer, but it seems others have the same difficulties.

It would be great suspending this puzzle till the crashing bug eliminated…

grogar7 Lv 1

This puzzle should be suspended or deprecated. Those (like my team mate Galaxie) who have not accepted the update to main, are able to run this puzzle unimpeded. Those who did accept the update are crashing regularly on 1207. Seems unfair!

actiasluna Lv 1

FYI - I'm running from a freshly installed (not updated to an existing) application running the updated Main and 1207 is stable for me. It's worth the time to do! Just be sure you save your active puzzles and share them with yourself, and save the options.txt and all.macro files (your recipes and settings) from the old version before ditching the old application and reinstalling.

(This is particularly important to do periodically on the Mac platform, in which Foldit gets "foldit bloat" - the application grows over time and things slow down.)