Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,232
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,544
  3. Avatar for Window Group 23. Window Group 1 pt. 0
  1. Avatar for fryguy 91. fryguy Lv 1 10 pts. 8,726
  2. Avatar for guineapig 92. guineapig Lv 1 10 pts. 8,726
  3. Avatar for YeshuaLives 93. YeshuaLives Lv 1 10 pts. 8,724
  4. Avatar for Giant Berk 94. Giant Berk Lv 1 9 pts. 8,718
  5. Avatar for hada 95. hada Lv 1 9 pts. 8,703
  6. Avatar for ecali 96. ecali Lv 1 9 pts. 8,700
  7. Avatar for BCAA 97. BCAA Lv 1 8 pts. 8,691
  8. Avatar for grogar7 98. grogar7 Lv 1 8 pts. 8,689
  9. Avatar for YGK 99. YGK Lv 1 8 pts. 8,681
  10. Avatar for JUMELLE54 100. JUMELLE54 Lv 1 8 pts. 8,664

Comments

Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.