Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups


  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,232
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,544
  3. Avatar for Window Group 23. Window Group 1 pt. 0

  1. Avatar for atomusuku 111. atomusuku Lv 1 5 pts. 8,543
  2. Avatar for katiekt94 112. katiekt94 Lv 1 5 pts. 8,535
  3. Avatar for t012 113. t012 Lv 1 5 pts. 8,531
  4. Avatar for bzipitidoo 114. bzipitidoo Lv 1 5 pts. 8,528
  5. Avatar for Iron pet 115. Iron pet Lv 1 5 pts. 8,482
  6. Avatar for boondog 116. boondog Lv 1 4 pts. 8,471
  7. Avatar for momadoc 117. momadoc Lv 1 4 pts. 8,463
  8. Avatar for kitek314_pl 118. kitek314_pl Lv 1 4 pts. 8,455
  9. Avatar for Petrifolder 119. Petrifolder Lv 1 4 pts. 8,455
  10. Avatar for tigger10 120. tigger10 Lv 1 4 pts. 8,447

Comments


Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.