Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,232
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,544
  3. Avatar for Window Group 23. Window Group 1 pt. 0
  1. Avatar for pocahy 161. pocahy Lv 1 1 pt. 7,644
  2. Avatar for TheStaticSloth 162. TheStaticSloth Lv 1 1 pt. 7,615
  3. Avatar for sean4046 163. sean4046 Lv 1 1 pt. 7,608
  4. Avatar for viniciussm 164. viniciussm Lv 1 1 pt. 7,604
  5. Avatar for SMackoff_Chem251-601 165. SMackoff_Chem251-601 Lv 1 1 pt. 7,558
  6. Avatar for DScott 166. DScott Lv 1 1 pt. 7,533
  7. Avatar for Tac1 167. Tac1 Lv 1 1 pt. 7,515
  8. Avatar for pandapharmd 168. pandapharmd Lv 1 1 pt. 7,515
  9. Avatar for Close At Hand 169. Close At Hand Lv 1 1 pt. 7,462
  10. Avatar for Wheeler22 170. Wheeler22 Lv 1 1 pt. 7,408

Comments

Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.