Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups


  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,232
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,544
  3. Avatar for Window Group 23. Window Group 1 pt. 0

  1. Avatar for MattTheGeek 11. MattTheGeek Lv 1 81 pts. 9,113
  2. Avatar for LociOiling 12. LociOiling Lv 1 80 pts. 9,109
  3. Avatar for crpainter 13. crpainter Lv 1 78 pts. 9,101
  4. Avatar for spmm 14. spmm Lv 1 76 pts. 9,098
  5. Avatar for Bruno Kestemont 15. Bruno Kestemont Lv 1 75 pts. 9,091
  6. Avatar for g_b 16. g_b Lv 1 73 pts. 9,082
  7. Avatar for mimi 17. mimi Lv 1 72 pts. 9,080
  8. Avatar for jermainiac 18. jermainiac Lv 1 70 pts. 9,072
  9. Avatar for mirp 19. mirp Lv 1 68 pts. 9,068
  10. Avatar for KarenCH 20. KarenCH Lv 1 67 pts. 9,067

Comments


Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.