Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups


  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,232
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,544
  3. Avatar for Window Group 23. Window Group 1 pt. 0

  1. Avatar for leegom 191. leegom Lv 1 1 pt. 6,966
  2. Avatar for Ernst Zundel 192. Ernst Zundel Lv 1 1 pt. 6,947
  3. Avatar for Festering Wounds 193. Festering Wounds Lv 1 1 pt. 6,947
  4. Avatar for justacea 194. justacea Lv 1 1 pt. 6,930
  5. Avatar for pandabearsecond 195. pandabearsecond Lv 1 1 pt. 6,923
  6. Avatar for Mohambone 196. Mohambone Lv 1 1 pt. 6,912
  7. Avatar for Truncheon Luncheon 197. Truncheon Luncheon Lv 1 1 pt. 6,899
  8. Avatar for hpenedones 199. hpenedones Lv 1 1 pt. 6,785
  9. Avatar for HMK 200. HMK Lv 1 1 pt. 6,762

Comments


Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.