Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups


  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,232
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,544
  3. Avatar for Window Group 23. Window Group 1 pt. 0

  1. Avatar for Deleted player 201. Deleted player pts. 6,700
  2. Avatar for mslinger-Chem251 202. mslinger-Chem251 Lv 1 1 pt. 6,683
  3. Avatar for bwkittitas 203. bwkittitas Lv 1 1 pt. 6,653
  4. Avatar for orz12 204. orz12 Lv 1 1 pt. 6,550
  5. Avatar for 5Science 205. 5Science Lv 1 1 pt. 6,472
  6. Avatar for Tsujimura 206. Tsujimura Lv 1 1 pt. 6,456
  7. Avatar for vbrown_Chem251-60 207. vbrown_Chem251-60 Lv 1 1 pt. 6,441
  8. Avatar for Mr_Jolty 208. Mr_Jolty Lv 1 1 pt. 6,377
  9. Avatar for GreekCivilization 209. GreekCivilization Lv 1 1 pt. 6,368

Comments


Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.