Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,232
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,544
  3. Avatar for Window Group 23. Window Group 1 pt. 0
  1. Avatar for apreiskimas 211. apreiskimas Lv 1 1 pt. 6,295
  2. Avatar for rrafique 212. rrafique Lv 1 1 pt. 6,291
  3. Avatar for briemoney 213. briemoney Lv 1 1 pt. 6,279
  4. Avatar for jvdzwan 214. jvdzwan Lv 1 1 pt. 6,259
  5. Avatar for aspadistra 215. aspadistra Lv 1 1 pt. 6,232
  6. Avatar for penteplayer 216. penteplayer Lv 1 1 pt. 6,223
  7. Avatar for MeighMeigh 217. MeighMeigh Lv 1 1 pt. 6,176
  8. Avatar for ivalnic 218. ivalnic Lv 1 1 pt. 6,147
  9. Avatar for sumanthratna 219. sumanthratna Lv 1 1 pt. 6,134
  10. Avatar for MaartenDesnouck 220. MaartenDesnouck Lv 1 1 pt. 6,111

Comments

Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.