Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,232
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,544
  3. Avatar for Window Group 23. Window Group 1 pt. 0
  1. Avatar for doctaven 231. doctaven Lv 1 1 pt. 5,544
  2. Avatar for Chrisxx75 232. Chrisxx75 Lv 1 1 pt. 4,994
  3. Avatar for Rofolt 233. Rofolt Lv 1 1 pt. 3,593
  4. Avatar for Idiotboy 234. Idiotboy Lv 1 1 pt. 0
  5. Avatar for packer 235. packer Lv 1 1 pt. 0
  6. Avatar for decbin 236. decbin Lv 1 1 pt. 0
  7. Avatar for lynnai 237. lynnai Lv 1 1 pt. 0
  8. Avatar for jflat06 238. jflat06 Lv 1 1 pt. 0
  9. Avatar for invisible8 239. invisible8 Lv 1 1 pt. 0
  10. Avatar for xplocast1 240. xplocast1 Lv 1 1 pt. 0

Comments

Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.