Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,232
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,544
  3. Avatar for Window Group 23. Window Group 1 pt. 0
  1. Avatar for Mark- 21. Mark- Lv 1 65 pts. 9,067
  2. Avatar for Bletchley Park 22. Bletchley Park Lv 1 64 pts. 9,063
  3. Avatar for tarimo 23. tarimo Lv 1 63 pts. 9,054
  4. Avatar for Blipperman 24. Blipperman Lv 1 61 pts. 9,052
  5. Avatar for MurloW 25. MurloW Lv 1 60 pts. 9,046
  6. Avatar for gloverd 26. gloverd Lv 1 58 pts. 9,045
  7. Avatar for reefyrob 27. reefyrob Lv 1 57 pts. 9,043
  8. Avatar for Scopper 28. Scopper Lv 1 56 pts. 9,041
  9. Avatar for pauldunn 29. pauldunn Lv 1 55 pts. 9,041
  10. Avatar for frood66 30. frood66 Lv 1 53 pts. 9,038

Comments

Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.