Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,232
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,544
  3. Avatar for Window Group 23. Window Group 1 pt. 0
  1. Avatar for nicobul 31. nicobul Lv 1 52 pts. 9,018
  2. Avatar for Mike Cassidy 32. Mike Cassidy Lv 1 51 pts. 9,015
  3. Avatar for Deleted player 33. Deleted player pts. 9,012
  4. Avatar for Timo van der Laan 34. Timo van der Laan Lv 1 49 pts. 9,010
  5. Avatar for Qfast 35. Qfast Lv 1 47 pts. 9,008
  6. Avatar for O Seki To 36. O Seki To Lv 1 46 pts. 9,001
  7. Avatar for jobo0502 37. jobo0502 Lv 1 45 pts. 8,987
  8. Avatar for christioanchauvin 38. christioanchauvin Lv 1 44 pts. 8,986
  9. Avatar for gurch 39. gurch Lv 1 43 pts. 8,984
  10. Avatar for justjustin 40. justjustin Lv 1 42 pts. 8,984

Comments

Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.