Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,232
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,544
  3. Avatar for Window Group 23. Window Group 1 pt. 0
  1. Avatar for nemo7731 41. nemo7731 Lv 1 41 pts. 8,982
  2. Avatar for Mike Lewis 42. Mike Lewis Lv 1 40 pts. 8,977
  3. Avatar for phi16 43. phi16 Lv 1 39 pts. 8,974
  4. Avatar for isaksson 44. isaksson Lv 1 38 pts. 8,969
  5. Avatar for Norrjane 45. Norrjane Lv 1 37 pts. 8,966
  6. Avatar for TomTaylor 46. TomTaylor Lv 1 36 pts. 8,957
  7. Avatar for fiendish_ghoul 47. fiendish_ghoul Lv 1 35 pts. 8,949
  8. Avatar for Museka 48. Museka Lv 1 34 pts. 8,943
  9. Avatar for Glen B 49. Glen B Lv 1 34 pts. 8,938
  10. Avatar for bertro 50. bertro Lv 1 33 pts. 8,934

Comments

Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.