Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups


  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,232
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,544
  3. Avatar for Window Group 23. Window Group 1 pt. 0

  1. Avatar for drumpeter18yrs9yrs 71. drumpeter18yrs9yrs Lv 1 19 pts. 8,852
  2. Avatar for pvc78 72. pvc78 Lv 1 18 pts. 8,844
  3. Avatar for ratqueen03 73. ratqueen03 Lv 1 18 pts. 8,842
  4. Avatar for sheerbliss 74. sheerbliss Lv 1 17 pts. 8,830
  5. Avatar for fishercat 75. fishercat Lv 1 17 pts. 8,824
  6. Avatar for steveB 76. steveB Lv 1 16 pts. 8,822
  7. Avatar for Crossed Sticks 77. Crossed Sticks Lv 1 16 pts. 8,821
  8. Avatar for diamonddays 78. diamonddays Lv 1 15 pts. 8,798
  9. Avatar for Franco Padelletti 79. Franco Padelletti Lv 1 15 pts. 8,793
  10. Avatar for deLaCeiba 80. deLaCeiba Lv 1 14 pts. 8,790

Comments


Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.