Placeholder image of a protein
Icon representing a puzzle

1210: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for FoldIt@Netherlands 21. FoldIt@Netherlands 1 pt. 8,467
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 8,417
  3. Avatar for Deleted group 23. Deleted group pts. 8,405
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 8,286
  1. Avatar for Slipknotfruit 161. Slipknotfruit Lv 1 1 pt. 8,519
  2. Avatar for mirjamvandelft 162. mirjamvandelft Lv 1 1 pt. 8,515
  3. Avatar for Iron pet 163. Iron pet Lv 1 1 pt. 8,513
  4. Avatar for Hoggord 164. Hoggord Lv 1 1 pt. 8,499
  5. Avatar for nagistick 165. nagistick Lv 1 1 pt. 8,497
  6. Avatar for tscarberry1 166. tscarberry1 Lv 1 1 pt. 8,496
  7. Avatar for Ryabov Anton 167. Ryabov Anton Lv 1 1 pt. 8,491
  8. Avatar for parsnip 168. parsnip Lv 1 1 pt. 8,489
  9. Avatar for isantheautumn 169. isantheautumn Lv 1 1 pt. 8,487
  10. Avatar for momadoc 170. momadoc Lv 1 1 pt. 8,487

Comments

jamiexq Lv 1

puzzle comments says there is one cys bond in this puzzle
I only see on cysteine in this puzzle, am I missing something? There is no way to form one cys bond here

Bletchley Park Lv 1

The secnd cys was possibly removed temporarily because of a bug in the client that causes crashes with cysteines.

bkoep Staff Lv 1

The original puzzle description was incorrect for this puzzle. I have amended the puzzle description.

There is only one cysteine in this protein, so no disulfides can form!