Placeholder image of a protein
Icon representing a puzzle

1210: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
March 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Beta Folders 100 pts. 8,949
  2. Avatar for Go Science 2. Go Science 81 pts. 8,878
  3. Avatar for Void Crushers 3. Void Crushers 64 pts. 8,854
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 50 pts. 8,842
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 39 pts. 8,807
  6. Avatar for Contenders 6. Contenders 30 pts. 8,806
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 8,799
  8. Avatar for HMT heritage 8. HMT heritage 17 pts. 8,784
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 12 pts. 8,744
  10. Avatar for Russian team 10. Russian team 9 pts. 8,724

  1. Avatar for greepski 31. greepski Lv 1 1 pt. 8,776
  2. Avatar for dbuske 32. dbuske Lv 1 1 pt. 8,775
  3. Avatar for TomTaylor 33. TomTaylor Lv 1 1 pt. 8,771
  4. Avatar for smholst 34. smholst Lv 1 1 pt. 8,771
  5. Avatar for Skippysk8s 35. Skippysk8s Lv 1 1 pt. 8,683
  6. Avatar for nemo7731 36. nemo7731 Lv 1 1 pt. 8,610
  7. Avatar for DrTree 37. DrTree Lv 1 1 pt. 8,580

Comments


jamiexq Lv 1

puzzle comments says there is one cys bond in this puzzle
I only see on cysteine in this puzzle, am I missing something? There is no way to form one cys bond here

Bletchley Park Lv 1

The secnd cys was possibly removed temporarily because of a bug in the client that causes crashes with cysteines.

bkoep Staff Lv 1

The original puzzle description was incorrect for this puzzle. I have amended the puzzle description.

There is only one cysteine in this protein, so no disulfides can form!