Placeholder image of a protein
Icon representing a puzzle

1213: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 30, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,475
  2. Avatar for Beta Folders 2. Beta Folders 83 pts. 10,465
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 68 pts. 10,450
  4. Avatar for Contenders 4. Contenders 55 pts. 10,440
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 44 pts. 10,416
  6. Avatar for Void Crushers 6. Void Crushers 35 pts. 10,384
  7. Avatar for HMT heritage 7. HMT heritage 27 pts. 10,383
  8. Avatar for Gargleblasters 8. Gargleblasters 21 pts. 10,300
  9. Avatar for Deleted group 9. Deleted group pts. 10,236
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 12 pts. 10,127
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,473
  2. Avatar for pmdpmd 2. pmdpmd Lv 1 98 pts. 10,450
  3. Avatar for bertro 3. bertro Lv 1 96 pts. 10,441
  4. Avatar for gitwut 4. gitwut Lv 1 94 pts. 10,440
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 92 pts. 10,439
  6. Avatar for LociOiling 6. LociOiling Lv 1 90 pts. 10,434
  7. Avatar for smilingone 7. smilingone Lv 1 88 pts. 10,428
  8. Avatar for mirp 8. mirp Lv 1 86 pts. 10,426
  9. Avatar for Deleted player 9. Deleted player pts. 10,418
  10. Avatar for Bletchley Park 10. Bletchley Park Lv 1 82 pts. 10,414

Comments

Bruno Kestemont Lv 1

Ran my 1207 test script on puzzle 1213 in main, with cysteines banded and filter off; crashed during wiggle after half an hour. No error in log.txt.

Susume Lv 1

Ran my 1207 test script on puzzle 1213 in main, with cysteines banded and filter off; crashed during wiggle after half an hour. No error in log.txt.

alcor29 Lv 1

The crashes aren't a surprise, since crashes with disulfide bridges have not been fixed yet. Unfortunately, the old version of the client won't work with this puzzle. Puzzle 1213 has a Rama map, which means old clients can't open it.

The only possible workaround is to avoid making any disulfide bridges until late in the game. If disulfides form, you may be able to break them by moving the sidechains apart. Freezing the sidechains should prevent the bridges from re-forming.