1213: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since almost 10 years ago

Summary

• Created: March 30, 2016
• Expires: April 06, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

• 1. Go Science 100 pts. 10,475
• 2. Beta Folders 83 pts. 10,465
• 3. L'Alliance Francophone 68 pts. 10,450
• 4. Contenders 55 pts. 10,440
• 5. Anthropic Dreams 44 pts. 10,416
• 6. Void Crushers 35 pts. 10,384
• 7. HMT heritage 27 pts. 10,383
• 8. Gargleblasters 21 pts. 10,300
• 9. Deleted group pts. 10,236
• 10. Italiani Al Lavoro 12 pts. 10,127

Top soloists

• 1. Bruno Kestemont 100 pts. 10,473
• 2. pmdpmd 98 pts. 10,450
• 3. bertro 96 pts. 10,441
• 4. gitwut 94 pts. 10,440
• 5. retiredmichael 92 pts. 10,439
• 6. LociOiling 90 pts. 10,434
• 7. smilingone 88 pts. 10,428
• 8. mirp 86 pts. 10,426
• 9. Deleted player pts. 10,418
• 10. Bletchley Park 82 pts. 10,414

Comments

[TomTaylor]

Three crashes in a 20 minutes period on this puzzle.

[LociOiling]

The crashes aren't a surprise, since crashes with disulfide bridges have not been fixed yet. Unfortunately, the old version of the client won't work with this puzzle. Puzzle 1213 has a Rama map, which means old clients can't open it.

The only possible workaround is to avoid making any disulfide bridges until late in the game. If disulfides form, you may be able to break them by moving the sidechains apart. Freezing the sidechains should prevent the bridges from re-forming.

[Bruno Kestemont]

seems to work

[johnmitch]

running win 10 main with filters on several clients without any crashes.

[Susume]

Ran my 1207 test script on puzzle 1213 in main, with cysteines banded and filter off; crashed during wiggle after half an hour. No error in log.txt.

[alcor29]

Running 3 disulfide bonds, main, Win 10, 64,(drw)

*** STARTING THREAD ActionGlobalMinimize
delta_score: 50.1436
Playing sound: 5
*** ENDING THREAD ActionGlobalMinimize
Tool on_action_complete called
Tool on_action_complete called
Tool on_action_complete called
Tool on_action_complete called
Tool on_action_complete called
*** STARTING THREAD ActionGlobalMinimize
delta_score: -356.433
Playing sound: 2
*** ENDING THREAD ActionGlobalMinimize
Tool on_action_complete called
***** STARTING THREAD ActionGlobalMinimize

UNHANDLED EXCEPTION
1: library_main +46812112 bytes (no line)
2: library_main +40217 bytes (no line)
3: library_main +44517492 bytes (no line)
4: library_main +25168 bytes (no line)
5: library_main +5509 bytes (no line)
6: library_main +42535263 bytes (no line)
7: library_main +41750807 bytes (no line)
8: library_main +41747510 bytes (no line)
9: library_main +41739662 bytes (no line)
10: library_main +37145835 bytes (no line)
11: library_main +37149947 bytes (no line)
12: library_main +33197162 bytes (no line)
13: library_main +33136830 bytes (no line)
14: library_main +5334996 bytes (no line)
15: library_main +5332860 bytes (no line)
16: library_main +4356837 bytes (no line)
17: library_main +4357291 bytes (no line)
18: BaseThreadInitThunk +36 bytes (no line)
19: RtlUnicodeStringToInteger +595 bytes (no line)
20: RtlUnicodeStringToInteger +542 bytes (no line)