Placeholder image of a protein
Icon representing a puzzle

1213: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
March 30, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for It's over 9000! 11. It's over 9000! 9 pts. 10,038
  2. Avatar for BOINC@Poland 12. BOINC@Poland 7 pts. 9,709
  3. Avatar for Bad Monkey 13. Bad Monkey 5 pts. 9,671
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 9,444
  5. Avatar for xkcd 15. xkcd 3 pts. 9,388
  6. Avatar for Deleted group 16. Deleted group pts. 9,190
  7. Avatar for foldeRNA 17. foldeRNA 1 pt. 9,144
  8. Avatar for D001x Med Chem MOOC 18. D001x Med Chem MOOC 1 pt. 9,023
  9. Avatar for Russian team 19. Russian team 1 pt. 9,011
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,983

  1. Avatar for grogar7 11. grogar7 Lv 1 80 pts. 10,411
  2. Avatar for KarenCH 12. KarenCH Lv 1 78 pts. 10,390
  3. Avatar for johnmitch 13. johnmitch Lv 1 76 pts. 10,389
  4. Avatar for Timo van der Laan 14. Timo van der Laan Lv 1 74 pts. 10,384
  5. Avatar for pauldunn 15. pauldunn Lv 1 73 pts. 10,377
  6. Avatar for O Seki To 16. O Seki To Lv 1 71 pts. 10,372
  7. Avatar for sheerbliss 17. sheerbliss Lv 1 69 pts. 10,366
  8. Avatar for hpaege 18. hpaege Lv 1 68 pts. 10,364
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 66 pts. 10,358
  10. Avatar for LagMasterSam 20. LagMasterSam Lv 1 64 pts. 10,342

Comments


LociOiling Lv 1

The crashes aren't a surprise, since crashes with disulfide bridges have not been fixed yet. Unfortunately, the old version of the client won't work with this puzzle. Puzzle 1213 has a Rama map, which means old clients can't open it.

The only possible workaround is to avoid making any disulfide bridges until late in the game. If disulfides form, you may be able to break them by moving the sidechains apart. Freezing the sidechains should prevent the bridges from re-forming.

Susume Lv 1

Ran my 1207 test script on puzzle 1213 in main, with cysteines banded and filter off; crashed during wiggle after half an hour. No error in log.txt.

alcor29 Lv 1

Running 3 disulfide bonds, main, Win 10, 64,(drw)

*** STARTING THREAD ActionGlobalMinimize
delta_score: 50.1436
Playing sound: 5
**
* ENDING THREAD ActionGlobalMinimize
Tool on_action_complete called
Tool on_action_complete called
Tool on_action_complete called
Tool on_action_complete called
Tool on_action_complete called
*** STARTING THREAD ActionGlobalMinimize
delta_score: -356.433
Playing sound: 2
**
* ENDING THREAD ActionGlobalMinimize
Tool on_action_complete called
***** STARTING THREAD ActionGlobalMinimize

UNHANDLED EXCEPTION
1: library_main +46812112 bytes (no line)
2: library_main +40217 bytes (no line)
3: library_main +44517492 bytes (no line)
4: library_main +25168 bytes (no line)
5: library_main +5509 bytes (no line)
6: library_main +42535263 bytes (no line)
7: library_main +41750807 bytes (no line)
8: library_main +41747510 bytes (no line)
9: library_main +41739662 bytes (no line)
10: library_main +37145835 bytes (no line)
11: library_main +37149947 bytes (no line)
12: library_main +33197162 bytes (no line)
13: library_main +33136830 bytes (no line)
14: library_main +5334996 bytes (no line)
15: library_main +5332860 bytes (no line)
16: library_main +4356837 bytes (no line)
17: library_main +4357291 bytes (no line)
18: BaseThreadInitThunk +36 bytes (no line)
19: RtlUnicodeStringToInteger +595 bytes (no line)
20: RtlUnicodeStringToInteger +542 bytes (no line)