Placeholder image of a protein
Icon representing a puzzle

1213: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 30, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 9 pts. 10,038
  2. Avatar for BOINC@Poland 12. BOINC@Poland 7 pts. 9,709
  3. Avatar for Bad Monkey 13. Bad Monkey 5 pts. 9,671
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 9,444
  5. Avatar for xkcd 15. xkcd 3 pts. 9,388
  6. Avatar for Deleted group 16. Deleted group pts. 9,190
  7. Avatar for foldeRNA 17. foldeRNA 1 pt. 9,144
  8. Avatar for D001x Med Chem MOOC 18. D001x Med Chem MOOC 1 pt. 9,023
  9. Avatar for Russian team 19. Russian team 1 pt. 9,011
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,983
  1. Avatar for jamiexq 81. jamiexq Lv 1 11 pts. 9,847
  2. Avatar for fishercat 82. fishercat Lv 1 11 pts. 9,827
  3. Avatar for Superphosphate 83. Superphosphate Lv 1 10 pts. 9,803
  4. Avatar for stomjoh 84. stomjoh Lv 1 10 pts. 9,761
  5. Avatar for SKSbell 85. SKSbell Lv 1 10 pts. 9,736
  6. Avatar for kitek314_pl 86. kitek314_pl Lv 1 9 pts. 9,709
  7. Avatar for andrewxc 87. andrewxc Lv 1 9 pts. 9,707
  8. Avatar for Incongruous 88. Incongruous Lv 1 9 pts. 9,702
  9. Avatar for MattTheGeek 89. MattTheGeek Lv 1 9 pts. 9,671
  10. Avatar for inkycatz 90. inkycatz Lv 1 8 pts. 9,656

Comments

Bruno Kestemont Lv 1

Ran my 1207 test script on puzzle 1213 in main, with cysteines banded and filter off; crashed during wiggle after half an hour. No error in log.txt.

Susume Lv 1

Ran my 1207 test script on puzzle 1213 in main, with cysteines banded and filter off; crashed during wiggle after half an hour. No error in log.txt.

alcor29 Lv 1

The crashes aren't a surprise, since crashes with disulfide bridges have not been fixed yet. Unfortunately, the old version of the client won't work with this puzzle. Puzzle 1213 has a Rama map, which means old clients can't open it.

The only possible workaround is to avoid making any disulfide bridges until late in the game. If disulfides form, you may be able to break them by moving the sidechains apart. Freezing the sidechains should prevent the bridges from re-forming.