Placeholder image of a protein
Icon representing a puzzle

1213: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
March 30, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Eὕρηκα! Heureka! 21. Eὕρηκα! Heureka! 1 pt. 8,980
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 8,891
  3. Avatar for Rechenkraft.net 23. Rechenkraft.net 1 pt. 8,817
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 8,817
  5. Avatar for Team South Africa 26. Team South Africa 1 pt. 8,703
  6. Avatar for Window Group 27. Window Group 1 pt. 8,274

  1. Avatar for pauldunn
    1. pauldunn Lv 1
    100 pts. 10,475
  2. Avatar for Paulo Roque 2. Paulo Roque Lv 1 86 pts. 10,475
  3. Avatar for mirp 3. mirp Lv 1 74 pts. 10,475
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 63 pts. 10,474
  5. Avatar for gloverd 5. gloverd Lv 1 53 pts. 10,473
  6. Avatar for Scopper 6. Scopper Lv 1 44 pts. 10,472
  7. Avatar for LociOiling 7. LociOiling Lv 1 37 pts. 10,465
  8. Avatar for smilingone 8. smilingone Lv 1 31 pts. 10,464
  9. Avatar for retiredmichael 9. retiredmichael Lv 1 25 pts. 10,463
  10. Avatar for sheerbliss 10. sheerbliss Lv 1 21 pts. 10,459

Comments


LociOiling Lv 1

The crashes aren't a surprise, since crashes with disulfide bridges have not been fixed yet. Unfortunately, the old version of the client won't work with this puzzle. Puzzle 1213 has a Rama map, which means old clients can't open it.

The only possible workaround is to avoid making any disulfide bridges until late in the game. If disulfides form, you may be able to break them by moving the sidechains apart. Freezing the sidechains should prevent the bridges from re-forming.

Susume Lv 1

Ran my 1207 test script on puzzle 1213 in main, with cysteines banded and filter off; crashed during wiggle after half an hour. No error in log.txt.

alcor29 Lv 1

Running 3 disulfide bonds, main, Win 10, 64,(drw)

*** STARTING THREAD ActionGlobalMinimize
delta_score: 50.1436
Playing sound: 5
**
* ENDING THREAD ActionGlobalMinimize
Tool on_action_complete called
Tool on_action_complete called
Tool on_action_complete called
Tool on_action_complete called
Tool on_action_complete called
*** STARTING THREAD ActionGlobalMinimize
delta_score: -356.433
Playing sound: 2
**
* ENDING THREAD ActionGlobalMinimize
Tool on_action_complete called
***** STARTING THREAD ActionGlobalMinimize

UNHANDLED EXCEPTION
1: library_main +46812112 bytes (no line)
2: library_main +40217 bytes (no line)
3: library_main +44517492 bytes (no line)
4: library_main +25168 bytes (no line)
5: library_main +5509 bytes (no line)
6: library_main +42535263 bytes (no line)
7: library_main +41750807 bytes (no line)
8: library_main +41747510 bytes (no line)
9: library_main +41739662 bytes (no line)
10: library_main +37145835 bytes (no line)
11: library_main +37149947 bytes (no line)
12: library_main +33197162 bytes (no line)
13: library_main +33136830 bytes (no line)
14: library_main +5334996 bytes (no line)
15: library_main +5332860 bytes (no line)
16: library_main +4356837 bytes (no line)
17: library_main +4357291 bytes (no line)
18: BaseThreadInitThunk +36 bytes (no line)
19: RtlUnicodeStringToInteger +595 bytes (no line)
20: RtlUnicodeStringToInteger +542 bytes (no line)