Placeholder image of a protein
Icon representing a puzzle

1213: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 30, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Eὕρηκα! Heureka! 21. Eὕρηκα! Heureka! 1 pt. 8,980
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 8,891
  3. Avatar for Rechenkraft.net 23. Rechenkraft.net 1 pt. 8,817
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 8,817
  5. Avatar for Richard Dawkins Foundation 25. Richard Dawkins Foundation 1 pt. 8,791
  6. Avatar for Team South Africa 26. Team South Africa 1 pt. 8,703
  7. Avatar for Window Group 27. Window Group 1 pt. 8,274
  1. Avatar for Soggy Doglog 101. Soggy Doglog Lv 1 6 pts. 9,461
  2. Avatar for Mr_Jolty 102. Mr_Jolty Lv 1 5 pts. 9,444
  3. Avatar for MaartenDesnouck 103. MaartenDesnouck Lv 1 5 pts. 9,437
  4. Avatar for Jim Fraser 104. Jim Fraser Lv 1 5 pts. 9,435
  5. Avatar for Colostomy EXPLOSION. 105. Colostomy EXPLOSION. Lv 1 5 pts. 9,414
  6. Avatar for hada 106. hada Lv 1 5 pts. 9,410
  7. Avatar for Merf 107. Merf Lv 1 4 pts. 9,397
  8. Avatar for fryguy 108. fryguy Lv 1 4 pts. 9,388
  9. Avatar for val.sch67 109. val.sch67 Lv 1 4 pts. 9,371
  10. Avatar for JUMELLE54 110. JUMELLE54 Lv 1 4 pts. 9,355

Comments

Bruno Kestemont Lv 1

Ran my 1207 test script on puzzle 1213 in main, with cysteines banded and filter off; crashed during wiggle after half an hour. No error in log.txt.

Susume Lv 1

Ran my 1207 test script on puzzle 1213 in main, with cysteines banded and filter off; crashed during wiggle after half an hour. No error in log.txt.

alcor29 Lv 1

The crashes aren't a surprise, since crashes with disulfide bridges have not been fixed yet. Unfortunately, the old version of the client won't work with this puzzle. Puzzle 1213 has a Rama map, which means old clients can't open it.

The only possible workaround is to avoid making any disulfide bridges until late in the game. If disulfides form, you may be able to break them by moving the sidechains apart. Freezing the sidechains should prevent the bridges from re-forming.