Placeholder image of a protein
Icon representing a puzzle

1213: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 30, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Eὕρηκα! Heureka! 21. Eὕρηκα! Heureka! 1 pt. 8,980
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 8,891
  3. Avatar for Rechenkraft.net 23. Rechenkraft.net 1 pt. 8,817
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 8,817
  5. Avatar for Richard Dawkins Foundation 25. Richard Dawkins Foundation 1 pt. 8,791
  6. Avatar for Team South Africa 26. Team South Africa 1 pt. 8,703
  7. Avatar for Window Group 27. Window Group 1 pt. 8,274
  1. Avatar for phi16 111. phi16 Lv 1 4 pts. 9,354
  2. Avatar for jebbiek 112. jebbiek Lv 1 4 pts. 9,351
  3. Avatar for Marvelz 113. Marvelz Lv 1 3 pts. 9,341
  4. Avatar for eromana 114. eromana Lv 1 3 pts. 9,327
  5. Avatar for tigger10 115. tigger10 Lv 1 3 pts. 9,315
  6. Avatar for mitarcher 116. mitarcher Lv 1 3 pts. 9,306
  7. Avatar for trebach 117. trebach Lv 1 3 pts. 9,295
  8. Avatar for arginia 118. arginia Lv 1 3 pts. 9,276
  9. Avatar for Crossed Sticks 119. Crossed Sticks Lv 1 3 pts. 9,274
  10. Avatar for Pro Lapser 120. Pro Lapser Lv 1 3 pts. 9,268

Comments

Bruno Kestemont Lv 1

Ran my 1207 test script on puzzle 1213 in main, with cysteines banded and filter off; crashed during wiggle after half an hour. No error in log.txt.

Susume Lv 1

Ran my 1207 test script on puzzle 1213 in main, with cysteines banded and filter off; crashed during wiggle after half an hour. No error in log.txt.

alcor29 Lv 1

The crashes aren't a surprise, since crashes with disulfide bridges have not been fixed yet. Unfortunately, the old version of the client won't work with this puzzle. Puzzle 1213 has a Rama map, which means old clients can't open it.

The only possible workaround is to avoid making any disulfide bridges until late in the game. If disulfides form, you may be able to break them by moving the sidechains apart. Freezing the sidechains should prevent the bridges from re-forming.