Placeholder image of a protein
Icon representing a puzzle

1213: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 30, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Eὕρηκα! Heureka! 21. Eὕρηκα! Heureka! 1 pt. 8,980
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 8,891
  3. Avatar for Rechenkraft.net 23. Rechenkraft.net 1 pt. 8,817
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 8,817
  5. Avatar for Richard Dawkins Foundation 25. Richard Dawkins Foundation 1 pt. 8,791
  6. Avatar for Team South Africa 26. Team South Africa 1 pt. 8,703
  7. Avatar for Window Group 27. Window Group 1 pt. 8,274
  1. Avatar for KT313 161. KT313 Lv 1 1 pt. 9,007
  2. Avatar for Gwing16 162. Gwing16 Lv 1 1 pt. 9,001
  3. Avatar for parsnip 163. parsnip Lv 1 1 pt. 8,983
  4. Avatar for Tlaloc 164. Tlaloc Lv 1 1 pt. 8,983
  5. Avatar for FreeT 165. FreeT Lv 1 1 pt. 8,981
  6. Avatar for Savas 166. Savas Lv 1 1 pt. 8,980
  7. Avatar for oceanic1986 167. oceanic1986 Lv 1 1 pt. 8,977
  8. Avatar for almax22 168. almax22 Lv 1 1 pt. 8,970
  9. Avatar for Tac1 169. Tac1 Lv 1 1 pt. 8,946
  10. Avatar for yoyoparis 170. yoyoparis Lv 1 1 pt. 8,940

Comments

Bruno Kestemont Lv 1

Ran my 1207 test script on puzzle 1213 in main, with cysteines banded and filter off; crashed during wiggle after half an hour. No error in log.txt.

Susume Lv 1

Ran my 1207 test script on puzzle 1213 in main, with cysteines banded and filter off; crashed during wiggle after half an hour. No error in log.txt.

alcor29 Lv 1

The crashes aren't a surprise, since crashes with disulfide bridges have not been fixed yet. Unfortunately, the old version of the client won't work with this puzzle. Puzzle 1213 has a Rama map, which means old clients can't open it.

The only possible workaround is to avoid making any disulfide bridges until late in the game. If disulfides form, you may be able to break them by moving the sidechains apart. Freezing the sidechains should prevent the bridges from re-forming.