Placeholder image of a protein
Icon representing a puzzle

1215: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate

Summary

Created
April 02, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle was mistakenly posted with the incorrect sequence, and was taken down early. A corrected puzzle has been posted as Puzzle 1215b.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 8,390
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 7,607
  3. Avatar for Deleted group 13. Deleted group pts. 5,349
  1. Avatar for jungenkind 91. jungenkind Lv 1 1 pt. 4,843
  2. Avatar for harvardman 92. harvardman Lv 1 1 pt. 4,600
  3. Avatar for Evgeny17 93. Evgeny17 Lv 1 1 pt. 4,445
  4. Avatar for GreekCivilization 94. GreekCivilization Lv 1 1 pt. 3,613
  5. Avatar for t012 95. t012 Lv 1 1 pt. 0
  6. Avatar for multaq 96. multaq Lv 1 1 pt. 0
  7. Avatar for Susume 97. Susume Lv 1 1 pt. 0
  8. Avatar for AliceMegatron 98. AliceMegatron Lv 1 1 pt. 0
  9. Avatar for Scopper 99. Scopper Lv 1 1 pt. 0
  10. Avatar for retiredmichael 100. retiredmichael Lv 1 1 pt. 0

Comments

Susume Lv 1

The sequence given above does not match the puzzle. The actual sequence is:
TTRVRVVGNGKVVEVHVGPDGIEVNIVRNGRSETIREKGTGGPEELKRIMDKVRERGNGDPVVNEVVRVVRKIINE