Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 9,245
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,244
  3. Avatar for Gargleblasters 3. Gargleblasters 61 pts. 9,219
  4. Avatar for Contenders 4. Contenders 47 pts. 9,218
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 35 pts. 9,173
  6. Avatar for Go Science 6. Go Science 26 pts. 9,170
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 19 pts. 9,154
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,084
  9. Avatar for BOINC@Poland 9. BOINC@Poland 10 pts. 9,020
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 8,987
  1. Avatar for Timo van der Laan
    1. Timo van der Laan Lv 1
    100 pts. 9,245
  2. Avatar for bertro 2. bertro Lv 1 98 pts. 9,243
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 96 pts. 9,214
  4. Avatar for LagMasterSam 4. LagMasterSam Lv 1 94 pts. 9,212
  5. Avatar for Blipperman 5. Blipperman Lv 1 92 pts. 9,208
  6. Avatar for gitwut 6. gitwut Lv 1 90 pts. 9,203
  7. Avatar for LociOiling 7. LociOiling Lv 1 88 pts. 9,201
  8. Avatar for crpainter 8. crpainter Lv 1 86 pts. 9,192
  9. Avatar for Mike Cassidy 9. Mike Cassidy Lv 1 84 pts. 9,182
  10. Avatar for Museka 10. Museka Lv 1 82 pts. 9,173

Comments