Placeholder image of a protein
Icon representing a puzzle

1215: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate

Summary


Created
April 02, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle was mistakenly posted with the incorrect sequence, and was taken down early. A corrected puzzle has been posted as Puzzle 1215b.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 8,390
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 7,607
  3. Avatar for Deleted group 13. Deleted group pts. 5,349

  1. Avatar for O Seki To 21. O Seki To Lv 1 33 pts. 8,969
  2. Avatar for ViJay7019 22. ViJay7019 Lv 1 31 pts. 8,962
  3. Avatar for pauldunn 23. pauldunn Lv 1 29 pts. 8,957
  4. Avatar for MattTheGeek 24. MattTheGeek Lv 1 27 pts. 8,947
  5. Avatar for caglar 25. caglar Lv 1 25 pts. 8,932
  6. Avatar for KarenCH 26. KarenCH Lv 1 24 pts. 8,923
  7. Avatar for drumpeter18yrs9yrs 27. drumpeter18yrs9yrs Lv 1 22 pts. 8,916
  8. Avatar for mimi 28. mimi Lv 1 21 pts. 8,825
  9. Avatar for LociOiling 29. LociOiling Lv 1 19 pts. 8,795
  10. Avatar for grogar7 30. grogar7 Lv 1 18 pts. 8,777

Comments


Susume Lv 1

The sequence given above does not match the puzzle. The actual sequence is:
TTRVRVVGNGKVVEVHVGPDGIEVNIVRNGRSETIREKGTGGPEELKRIMDKVRERGNGDPVVNEVVRVVRKIINE