Placeholder image of a protein
Icon representing a puzzle

1215: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate

Summary

Created
April 02, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle was mistakenly posted with the incorrect sequence, and was taken down early. A corrected puzzle has been posted as Puzzle 1215b.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 8,390
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 7,607
  3. Avatar for Deleted group 13. Deleted group pts. 5,349
  1. Avatar for uihcv 31. uihcv Lv 1 17 pts. 8,759
  2. Avatar for deLaCeiba 32. deLaCeiba Lv 1 16 pts. 8,753
  3. Avatar for pvc78 33. pvc78 Lv 1 15 pts. 8,747
  4. Avatar for isaksson 34. isaksson Lv 1 14 pts. 8,733
  5. Avatar for Mark- 35. Mark- Lv 1 13 pts. 8,689
  6. Avatar for manu8170 36. manu8170 Lv 1 12 pts. 8,668
  7. Avatar for Merf 37. Merf Lv 1 11 pts. 8,635
  8. Avatar for tyoung03 38. tyoung03 Lv 1 10 pts. 8,588
  9. Avatar for ManVsYard 39. ManVsYard Lv 1 9 pts. 8,582
  10. Avatar for Incongruous 40. Incongruous Lv 1 9 pts. 8,519

Comments

Susume Lv 1

The sequence given above does not match the puzzle. The actual sequence is:
TTRVRVVGNGKVVEVHVGPDGIEVNIVRNGRSETIREKGTGGPEELKRIMDKVRERGNGDPVVNEVVRVVRKIINE