Placeholder image of a protein
Icon representing a puzzle

1215: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate

Summary

Created
April 02, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle was mistakenly posted with the incorrect sequence, and was taken down early. A corrected puzzle has been posted as Puzzle 1215b.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 8,390
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 7,607
  3. Avatar for Deleted group 13. Deleted group pts. 5,349
  1. Avatar for Bruno Kestemont 51. Bruno Kestemont Lv 1 3 pts. 8,151
  2. Avatar for severin333 52. severin333 Lv 1 3 pts. 8,142
  3. Avatar for dbuske 53. dbuske Lv 1 3 pts. 8,137
  4. Avatar for phi16 54. phi16 Lv 1 3 pts. 8,117
  5. Avatar for Arne Heessels 55. Arne Heessels Lv 1 2 pts. 8,072
  6. Avatar for martinf 56. martinf Lv 1 2 pts. 8,056
  7. Avatar for momadoc 57. momadoc Lv 1 2 pts. 7,968
  8. Avatar for Hollinas 58. Hollinas Lv 1 2 pts. 7,882
  9. Avatar for Punktchen 59. Punktchen Lv 1 2 pts. 7,862
  10. Avatar for parsnip 60. parsnip Lv 1 2 pts. 7,778

Comments

Susume Lv 1

The sequence given above does not match the puzzle. The actual sequence is:
TTRVRVVGNGKVVEVHVGPDGIEVNIVRNGRSETIREKGTGGPEELKRIMDKVRERGNGDPVVNEVVRVVRKIINE