Placeholder image of a protein
Icon representing a puzzle

1215: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate

Summary

Created
April 02, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle was mistakenly posted with the incorrect sequence, and was taken down early. A corrected puzzle has been posted as Puzzle 1215b.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 8,390
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 7,607
  3. Avatar for Deleted group 13. Deleted group pts. 5,349
  1. Avatar for Graham MF 61. Graham MF Lv 1 1 pt. 7,645
  2. Avatar for HMK 62. HMK Lv 1 1 pt. 7,607
  3. Avatar for eromana 63. eromana Lv 1 1 pt. 7,577
  4. Avatar for arginia 64. arginia Lv 1 1 pt. 7,553
  5. Avatar for rinze 65. rinze Lv 1 1 pt. 7,533
  6. Avatar for MaartenDesnouck 66. MaartenDesnouck Lv 1 1 pt. 7,463
  7. Avatar for 01010011111 67. 01010011111 Lv 1 1 pt. 7,457
  8. Avatar for NinjaGreg 68. NinjaGreg Lv 1 1 pt. 7,424
  9. Avatar for cnhrcolemam 69. cnhrcolemam Lv 1 1 pt. 7,398
  10. Avatar for Epikmann 70. Epikmann Lv 1 1 pt. 7,348

Comments

Susume Lv 1

The sequence given above does not match the puzzle. The actual sequence is:
TTRVRVVGNGKVVEVHVGPDGIEVNIVRNGRSETIREKGTGGPEELKRIMDKVRERGNGDPVVNEVVRVVRKIINE