Placeholder image of a protein
Icon representing a puzzle

1215: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate

Summary

Created
April 02, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle was mistakenly posted with the incorrect sequence, and was taken down early. A corrected puzzle has been posted as Puzzle 1215b.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 8,390
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 7,607
  3. Avatar for Deleted group 13. Deleted group pts. 5,349
  1. Avatar for jarbolol15 81. jarbolol15 Lv 1 1 pt. 5,877
  2. Avatar for karost 82. karost Lv 1 1 pt. 5,844
  3. Avatar for smilingone 83. smilingone Lv 1 1 pt. 5,545
  4. Avatar for briemoney 84. briemoney Lv 1 1 pt. 5,349
  5. Avatar for Gryn 85. Gryn Lv 1 1 pt. 5,323
  6. Avatar for D001x_RamsesAlfaro 86. D001x_RamsesAlfaro Lv 1 1 pt. 5,322
  7. Avatar for kubays 87. kubays Lv 1 1 pt. 5,318
  8. Avatar for capnsilly 88. capnsilly Lv 1 1 pt. 5,294
  9. Avatar for jamiexq 89. jamiexq Lv 1 1 pt. 5,207
  10. Avatar for Leriel 90. Leriel Lv 1 1 pt. 5,114

Comments

Susume Lv 1

The sequence given above does not match the puzzle. The actual sequence is:
TTRVRVVGNGKVVEVHVGPDGIEVNIVRNGRSETIREKGTGGPEELKRIMDKVRERGNGDPVVNEVVRVVRKIINE