Placeholder image of a protein
Icon representing a puzzle

1215: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate

Summary

Created
April 02, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle was mistakenly posted with the incorrect sequence, and was taken down early. A corrected puzzle has been posted as Puzzle 1215b.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,271
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 9,123
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 9,082
  4. Avatar for Go Science 4. Go Science 24 pts. 9,075
  5. Avatar for Beta Folders 5. Beta Folders 14 pts. 9,062
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 9,026
  7. Avatar for HMT heritage 7. HMT heritage 4 pts. 8,969
  8. Avatar for Bad Monkey 8. Bad Monkey 2 pts. 8,947
  9. Avatar for Deleted group 9. Deleted group pts. 8,916
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 8,753
  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 9,062
  2. Avatar for ViJay7019 2. ViJay7019 Lv 1 24 pts. 9,047
  3. Avatar for gloverd 3. gloverd Lv 1 4 pts. 9,030
  4. Avatar for ManVsYard 4. ManVsYard Lv 1 1 pt. 9,018
  5. Avatar for mirp 5. mirp Lv 1 1 pt. 8,933

Comments

Susume Lv 1

The sequence given above does not match the puzzle. The actual sequence is:
TTRVRVVGNGKVVEVHVGPDGIEVNIVRNGRSETIREKGTGGPEELKRIMDKVRERGNGDPVVNEVVRVVRKIINE