Placeholder image of a protein
Icon representing a puzzle

1215: Unsolved De-novo Freestyle 76

Closed since about 10 years ago

Intermediate

Summary


Created
April 02, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle was mistakenly posted with the incorrect sequence, and was taken down early. A corrected puzzle has been posted as Puzzle 1215b.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Contenders 100 pts. 9,271
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 9,123
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 9,082
  4. Avatar for Go Science 4. Go Science 24 pts. 9,075
  5. Avatar for Beta Folders 5. Beta Folders 14 pts. 9,062
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 9,026
  7. Avatar for HMT heritage 7. HMT heritage 4 pts. 8,969
  8. Avatar for Bad Monkey 8. Bad Monkey 2 pts. 8,947
  9. Avatar for Deleted group 9. Deleted group pts. 8,916
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 8,753

  1. Avatar for jungenkind 91. jungenkind Lv 1 1 pt. 4,843
  2. Avatar for harvardman 92. harvardman Lv 1 1 pt. 4,600
  3. Avatar for Evgeny17 93. Evgeny17 Lv 1 1 pt. 4,445
  4. Avatar for GreekCivilization 94. GreekCivilization Lv 1 1 pt. 3,613
  5. Avatar for t012 95. t012 Lv 1 1 pt. 0
  6. Avatar for multaq 96. multaq Lv 1 1 pt. 0
  7. Avatar for Susume 97. Susume Lv 1 1 pt. 0
  8. Avatar for Scopper 99. Scopper Lv 1 1 pt. 0

Comments


Susume Lv 1

The sequence given above does not match the puzzle. The actual sequence is:
TTRVRVVGNGKVVEVHVGPDGIEVNIVRNGRSETIREKGTGGPEELKRIMDKVRERGNGDPVVNEVVRVVRKIINE