Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,853
  2. Avatar for Bad Monkey 12. Bad Monkey 3 pts. 8,778
  3. Avatar for Mojo Risin' 13. Mojo Risin' 2 pts. 8,530
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,436
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,166
  6. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,144
  7. Avatar for Natural Abilities 18. Natural Abilities 1 pt. 7,144
  8. Avatar for Deleted group 19. Deleted group pts. 6,656
  9. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,653

  1. Avatar for xplocast1 141. xplocast1 Lv 1 1 pt. 8,105
  2. Avatar for AlanmanAaron 142. AlanmanAaron Lv 1 1 pt. 8,094
  3. Avatar for PatPetersen127 143. PatPetersen127 Lv 1 1 pt. 8,093
  4. Avatar for GreekCivilization 144. GreekCivilization Lv 1 1 pt. 8,089
  5. Avatar for almax22 145. almax22 Lv 1 1 pt. 8,057
  6. Avatar for nagistick 146. nagistick Lv 1 1 pt. 8,049
  7. Avatar for Graham MF 147. Graham MF Lv 1 1 pt. 8,034
  8. Avatar for Iron pet 148. Iron pet Lv 1 1 pt. 8,026
  9. Avatar for AeonFluff 149. AeonFluff Lv 1 1 pt. 8,013
  10. Avatar for Arne Heessels 150. Arne Heessels Lv 1 1 pt. 8,010

Comments