Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,853
  2. Avatar for Bad Monkey 12. Bad Monkey 3 pts. 8,778
  3. Avatar for Mojo Risin' 13. Mojo Risin' 2 pts. 8,530
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,436
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,166
  6. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,144
  7. Avatar for Richard Dawkins Foundation 17. Richard Dawkins Foundation 1 pt. 7,976
  8. Avatar for Natural Abilities 18. Natural Abilities 1 pt. 7,144
  9. Avatar for Deleted group 19. Deleted group pts. 6,656
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,653
  1. Avatar for TJOK fan 191. TJOK fan Lv 1 1 pt. 7,139
  2. Avatar for isantheautumn 192. isantheautumn Lv 1 1 pt. 7,138
  3. Avatar for Mohambone 193. Mohambone Lv 1 1 pt. 7,134
  4. Avatar for NameChangeNeeded01 194. NameChangeNeeded01 Lv 1 1 pt. 7,128
  5. Avatar for mondetta77 195. mondetta77 Lv 1 1 pt. 7,107
  6. Avatar for larry25427 196. larry25427 Lv 1 1 pt. 7,076
  7. Avatar for DScott 197. DScott Lv 1 1 pt. 7,054
  8. Avatar for tscarberry1 198. tscarberry1 Lv 1 1 pt. 6,656
  9. Avatar for doctaven 199. doctaven Lv 1 1 pt. 6,653
  10. Avatar for MaartenDesnouck 200. MaartenDesnouck Lv 1 1 pt. 6,618

Comments