Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,853
  2. Avatar for Bad Monkey 12. Bad Monkey 3 pts. 8,778
  3. Avatar for Mojo Risin' 13. Mojo Risin' 2 pts. 8,530
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,436
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,166
  6. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,144
  7. Avatar for Richard Dawkins Foundation 17. Richard Dawkins Foundation 1 pt. 7,976
  8. Avatar for Natural Abilities 18. Natural Abilities 1 pt. 7,144
  9. Avatar for Deleted group 19. Deleted group pts. 6,656
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,653
  1. Avatar for bogee 211. bogee Lv 1 1 pt. 5,943
  2. Avatar for gempetros 212. gempetros Lv 1 1 pt. 5,885
  3. Avatar for citric acid 213. citric acid Lv 1 1 pt. 5,844
  4. Avatar for Je Maintiendrai 214. Je Maintiendrai Lv 1 1 pt. 5,824
  5. Avatar for lamoille 215. lamoille Lv 1 1 pt. 5,817
  6. Avatar for cath6901 216. cath6901 Lv 1 1 pt. 5,817
  7. Avatar for ragemonkey808 217. ragemonkey808 Lv 1 1 pt. 5,722
  8. Avatar for sansplomb98 218. sansplomb98 Lv 1 1 pt. 5,509
  9. Avatar for marasolc 219. marasolc Lv 1 1 pt. 5,495
  10. Avatar for vissong 220. vissong Lv 1 1 pt. 5,489

Comments