Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,853
  2. Avatar for Bad Monkey 12. Bad Monkey 3 pts. 8,778
  3. Avatar for Mojo Risin' 13. Mojo Risin' 2 pts. 8,530
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,436
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,166
  6. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,144
  7. Avatar for Natural Abilities 18. Natural Abilities 1 pt. 7,144
  8. Avatar for Deleted group 19. Deleted group pts. 6,656
  9. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,653

  1. Avatar for O Seki To 21. O Seki To Lv 1 64 pts. 9,084
  2. Avatar for Qfast 22. Qfast Lv 1 63 pts. 9,074
  3. Avatar for bendbob 23. bendbob Lv 1 61 pts. 9,070
  4. Avatar for Deleted player 24. Deleted player pts. 9,069
  5. Avatar for johnmitch 25. johnmitch Lv 1 58 pts. 9,067
  6. Avatar for gmn 26. gmn Lv 1 57 pts. 9,065
  7. Avatar for spvincent 27. spvincent Lv 1 56 pts. 9,063
  8. Avatar for SamuelJackson 28. SamuelJackson Lv 1 54 pts. 9,054
  9. Avatar for Norrjane 29. Norrjane Lv 1 53 pts. 9,046
  10. Avatar for Scopper 30. Scopper Lv 1 52 pts. 9,038

Comments