Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,853
  2. Avatar for Bad Monkey 12. Bad Monkey 3 pts. 8,778
  3. Avatar for Mojo Risin' 13. Mojo Risin' 2 pts. 8,530
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,436
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,166
  6. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,144
  7. Avatar for Natural Abilities 18. Natural Abilities 1 pt. 7,144
  8. Avatar for Deleted group 19. Deleted group pts. 6,656
  9. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,653

  1. Avatar for andrewxc 41. andrewxc Lv 1 39 pts. 8,966
  2. Avatar for tarimo 42. tarimo Lv 1 38 pts. 8,964
  3. Avatar for jobo0502 43. jobo0502 Lv 1 37 pts. 8,961
  4. Avatar for Skippysk8s 44. Skippysk8s Lv 1 36 pts. 8,960
  5. Avatar for actiasluna 45. actiasluna Lv 1 35 pts. 8,950
  6. Avatar for TomTaylor 46. TomTaylor Lv 1 34 pts. 8,949
  7. Avatar for gloverd 47. gloverd Lv 1 33 pts. 8,946
  8. Avatar for stomjoh 48. stomjoh Lv 1 33 pts. 8,941
  9. Avatar for caglar 49. caglar Lv 1 32 pts. 8,933
  10. Avatar for KarenCH 50. KarenCH Lv 1 31 pts. 8,931

Comments