1215b: Unsolved De-novo Freestyle 76
Closed since about 10 years ago
Intermediate Overall PredictionSummary
- Created
- April 03, 2016
- Expires
- Max points
- 100
The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!
Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.
Sequence:
DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE