Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for GUGITBIOTECH 21. GUGITBIOTECH 1 pt. 6,242
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0

  1. Avatar for Timo van der Laan 100 pts. 9,245
  2. Avatar for bertro 2. bertro Lv 1 98 pts. 9,243
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 96 pts. 9,214
  4. Avatar for LagMasterSam 4. LagMasterSam Lv 1 94 pts. 9,212
  5. Avatar for Blipperman 5. Blipperman Lv 1 92 pts. 9,208
  6. Avatar for gitwut 6. gitwut Lv 1 90 pts. 9,203
  7. Avatar for LociOiling 7. LociOiling Lv 1 88 pts. 9,201
  8. Avatar for crpainter 8. crpainter Lv 1 86 pts. 9,192
  9. Avatar for Mike Cassidy 9. Mike Cassidy Lv 1 84 pts. 9,182
  10. Avatar for Museka 10. Museka Lv 1 82 pts. 9,173

Comments