Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for GUGITBIOTECH 21. GUGITBIOTECH 1 pt. 6,242
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0

  1. Avatar for cbwest 91. cbwest Lv 1 9 pts. 8,683
  2. Avatar for eromana 92. eromana Lv 1 9 pts. 8,681
  3. Avatar for nicobul 93. nicobul Lv 1 8 pts. 8,671
  4. Avatar for Incongruous 94. Incongruous Lv 1 8 pts. 8,655
  5. Avatar for deLaCeiba 95. deLaCeiba Lv 1 8 pts. 8,636
  6. Avatar for boondog 96. boondog Lv 1 8 pts. 8,629
  7. Avatar for Awgdawg 97. Awgdawg Lv 1 7 pts. 8,613
  8. Avatar for ManVsYard 98. ManVsYard Lv 1 7 pts. 8,607
  9. Avatar for gurch 99. gurch Lv 1 7 pts. 8,606
  10. Avatar for ViJay7019 100. ViJay7019 Lv 1 7 pts. 8,603

Comments