Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for GUGITBIOTECH 21. GUGITBIOTECH 1 pt. 6,242
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0

  1. Avatar for JUMELLE54 111. JUMELLE54 Lv 1 4 pts. 8,557
  2. Avatar for Merf 112. Merf Lv 1 4 pts. 8,539
  3. Avatar for arginia 113. arginia Lv 1 4 pts. 8,533
  4. Avatar for nbpitts 114. nbpitts Lv 1 4 pts. 8,531
  5. Avatar for Tlaloc 115. Tlaloc Lv 1 4 pts. 8,530
  6. Avatar for pfirth 116. pfirth Lv 1 4 pts. 8,517
  7. Avatar for Jim Fraser 117. Jim Fraser Lv 1 4 pts. 8,515
  8. Avatar for Bautho 118. Bautho Lv 1 3 pts. 8,514
  9. Avatar for rinze 119. rinze Lv 1 3 pts. 8,506
  10. Avatar for khendarg 120. khendarg Lv 1 3 pts. 8,487

Comments