Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for GUGITBIOTECH 21. GUGITBIOTECH 1 pt. 6,242
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0

  1. Avatar for guineapig 121. guineapig Lv 1 3 pts. 8,481
  2. Avatar for navn 122. navn Lv 1 3 pts. 8,473
  3. Avatar for SouperGenious 123. SouperGenious Lv 1 3 pts. 8,440
  4. Avatar for BCAA 124. BCAA Lv 1 3 pts. 8,436
  5. Avatar for Superphosphate 125. Superphosphate Lv 1 3 pts. 8,420
  6. Avatar for uihcv 126. uihcv Lv 1 3 pts. 8,419
  7. Avatar for Ernst Zundel 127. Ernst Zundel Lv 1 2 pts. 8,365
  8. Avatar for placid.lion 128. placid.lion Lv 1 2 pts. 8,316
  9. Avatar for senor pit 129. senor pit Lv 1 2 pts. 8,306
  10. Avatar for dbuske 130. dbuske Lv 1 2 pts. 8,304

Comments